PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g463140.1
Common NameMTR_8g463140
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family SBP
Protein Properties Length: 181aa    MW: 20625.2 Da    PI: 9.198
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g463140.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.72.9e-4264141178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +Cq+e+C adl++ak+yhrrhkvCe+hskapvv+v+g++qrfCqqCsrfh+l efDe+krsCrrrLa+hnerrrk+++
  Medtr8g463140.1  64 CCQAERCGADLTDAKRYHRRHKVCEFHSKAPVVVVAGMRQRFCQQCSRFHDLVEFDESKRSCRRRLAGHNERRRKTNP 141
                      6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.7E-3557126IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.46E-4062143IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.62462139IPR004333Transcription factor, SBP-box
PfamPF031101.0E-3165138IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MEARSIERKR TLMMEKMRRN NMVEEEMENE VEEEEGDVSL TEEEKKKGVG GGRRGGGGGV  60
SPPCCQAERC GADLTDAKRY HRRHKVCEFH SKAPVVVVAG MRQRFCQQCS RFHDLVEFDE  120
SKRSCRRRLA GHNERRRKTN PETANEGSSH SKGQHQPKET QCRIQMNLPG SSGYKSFNIR  180
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-3755138184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15058GGRRGGGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00634PBMTransfer from PK22320.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013445497.11e-130squamosa promoter-binding-like protein
SwissprotQ387405e-44SBP2_ANTMA; Squamosa promoter-binding protein 2
TrEMBLA0A072TRQ41e-130A0A072TRQ4_MEDTR; Squamosa promoter-binding-like protein
STRINGGLYMA12G27330.13e-69(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53534153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.22e-40squamosa promoter binding protein-like 4
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]